Lineage for d1usub_ (1usu B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 607004Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies)
    core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander
  4. 607013Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family) (S)
    consists of a single domain of this fold
  5. 607014Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein)
  6. 607015Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species)
  7. 607016Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries)
  8. 607017Domain d1usub_: 1usu B: [99886]
    Other proteins in same PDB: d1usua_
    complexed with a Hsp90 domain
    complexed with gol

Details for d1usub_

PDB Entry: 1usu (more details), 2.15 Å

PDB Description: the structure of the complex between aha1 and hsp90

SCOP Domain Sequences for d1usub_:

Sequence, based on SEQRES records: (download)

>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae)}
vdkncigwakeyfkqkivgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlki
tvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirsel
lpklrqifqqfgkdllathgnd

Sequence, based on observed residues (ATOM records): (download)

>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae)}
vdkncigwakeyfkqkivgveakkyakiksvssiegdcevnqrgkvislfdlkitvlieg
hvdsalpfegsinvpevafdseassyqfdisifketselseakplirsellpklrqifqq
fgkdllathgnd

SCOP Domain Coordinates for d1usub_:

Click to download the PDB-style file with coordinates for d1usub_.
(The format of our PDB-style files is described here.)

Timeline for d1usub_: