![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies) core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander |
![]() | Superfamily d.83.2: Activator of Hsp90 ATPase, Aha1 [103111] (1 family) ![]() consists of a single domain of this fold |
![]() | Family d.83.2.1: Activator of Hsp90 ATPase, Aha1 [103112] (1 protein) |
![]() | Protein Activator of Hsp90 ATPase, Aha1 [103113] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103114] (2 PDB entries) |
![]() | Domain d1usub_: 1usu B: [99886] Other proteins in same PDB: d1usua_ complexed with a Hsp90 domain |
PDB Entry: 1usu (more details), 2.15 Å
SCOP Domain Sequences for d1usub_:
Sequence, based on SEQRES records: (download)
>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae)} vdkncigwakeyfkqkivgveagsvkdkkyakiksvssiegdcevnqrkgkvislfdlki tvlieghvdskdgsalpfegsinvpevafdseassyqfdisifketselseakplirsel lpklrqifqqfgkdllathgnd
>d1usub_ d.83.2.1 (B:) Activator of Hsp90 ATPase, Aha1 {Baker's yeast (Saccharomyces cerevisiae)} vdkncigwakeyfkqkivgveakkyakiksvssiegdcevnqrgkvislfdlkitvlieg hvdsalpfegsinvpevafdseassyqfdisifketselseakplirsellpklrqifqq fgkdllathgnd
Timeline for d1usub_: