Lineage for d1ussa_ (1uss A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693281Family a.4.5.13: Linker histone H1/H5 [46827] (4 proteins)
    automatically mapped to Pfam PF00538
  6. 2693282Protein Histone H1 homologue Hho1p [101037] (1 species)
    duplication: contains two similar globular domains
  7. 2693283Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries)
  8. 2693285Domain d1ussa_: 1uss A: [99883]
    C-terminal globular domain, GII

Details for d1ussa_

PDB Entry: 1uss (more details)

PDB Description: yeast histone h1 globular domain ii, hho1p gii, solution nmr structures
PDB Compounds: (A:) Histone H1

SCOPe Domain Sequences for d1ussa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kasspssltykemilksmpqlndgkgssrivlkkyvkdtfssklktssnfdylfnsaikk
cvengelvqpkgpsgiiklnkkkvklst

SCOPe Domain Coordinates for d1ussa_:

Click to download the PDB-style file with coordinates for d1ussa_.
(The format of our PDB-style files is described here.)

Timeline for d1ussa_: