Lineage for d1usra_ (1usr A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379505Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 379506Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 379507Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 379604Protein Paramyxovirus hemagglutinin-neuraminidase head domain [63823] (1 species)
  7. 379605Species Newcastle disease virus [TaxId:11176] [63824] (5 PDB entries)
  8. 379606Domain d1usra_: 1usr A: [99881]

Details for d1usra_

PDB Entry: 1usr (more details), 2 Å

PDB Description: newcastle disease virus hemagglutinin-neuraminidase: evidence for a second sialic acid binding site and implications for fusion

SCOP Domain Sequences for d1usra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usra_ b.68.1.1 (A:) Paramyxovirus hemagglutinin-neuraminidase head domain {Newcastle disease virus}
gapihdpdfiggigkelivdnasdvtsfypsafqehlnfipapttgsgctripsfdmsat
hycythnvilsgcrdhshshqylalgvlrttatgriffstlrsislddtqnrkscsvsat
plgcdmlcskvteteeedynsavptlmahgrlgfdgqyhekdldvttlfedwvanypgvg
ggsfidgrvwfsvygglkpnspsdtvqegkyviykryndtcpdeqdyqirmakssykpgr
fggkriqqailsikvstslgedpvltvppntvtlmgaegriltvgtshflyqrgssyfsp
allypmtvsnktatlhspytfnaftrpgsipcqasarcpnscvtgvytdpyplifyrnht
lrgvfgtmldseqarlnpasavfdstsrsritrvsssstkaayttstcfkvvktnktycl
siaeisntlfgefrivpllveilkndgv

SCOP Domain Coordinates for d1usra_:

Click to download the PDB-style file with coordinates for d1usra_.
(The format of our PDB-style files is described here.)

Timeline for d1usra_: