Lineage for d1uspb_ (1usp B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007845Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 3007846Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 3007847Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. 3007875Protein Organic hydroperoxide resistance protein Ohr [82786] (3 species)
  7. 3007876Species Deinococcus radiodurans [TaxId:1299] [103270] (1 PDB entry)
  8. 3007878Domain d1uspb_: 1usp B: [99880]
    complexed with gol

Details for d1uspb_

PDB Entry: 1usp (more details), 1.9 Å

PDB Description: organic hydroperoxide resistance protein from deinococcus radiodurans
PDB Compounds: (B:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d1uspb_:

Sequence, based on SEQRES records: (download)

>d1uspb_ d.227.1.1 (B:) Organic hydroperoxide resistance protein Ohr {Deinococcus radiodurans [TaxId: 1299]}
anvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqga
lgvvsrrnkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahevc
pysaatrnnvdvrlkvre

Sequence, based on observed residues (ATOM records): (download)

>d1uspb_ d.227.1.1 (B:) Organic hydroperoxide resistance protein Ohr {Deinococcus radiodurans [TaxId: 1299]}
anvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqga
lgvvsrrnkidvpadstitarvglqkfaldveleghfpglsreqaeglmhaahevcpysa
atrnnvdvrlkvre

SCOPe Domain Coordinates for d1uspb_:

Click to download the PDB-style file with coordinates for d1uspb_.
(The format of our PDB-style files is described here.)

Timeline for d1uspb_: