Lineage for d1uspa_ (1usp A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423210Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 423211Superfamily d.227.1: OsmC-like [82784] (2 families) (S)
  5. 423212Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (3 proteins)
  6. 423228Protein Organic hydroperoxide resistance protein Ohr [82786] (2 species)
  7. 423229Species Deinococcus radiodurans [TaxId:1299] [103270] (1 PDB entry)
  8. 423230Domain d1uspa_: 1usp A: [99879]

Details for d1uspa_

PDB Entry: 1usp (more details), 1.9 Å

PDB Description: organic hydroperoxide resistance protein from deinococcus radiodurans

SCOP Domain Sequences for d1uspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uspa_ d.227.1.1 (A:) Organic hydroperoxide resistance protein Ohr {Deinococcus radiodurans}
nvytaeatatggragttrssddrlnldlsvpaemggdggpgtnpeqlfaagyaacfqgal
gvvsrrqkidvpadstitarvglqkaglafaldveleghfpglsreqaeglmhaahevcp
ysaatrnnvdvrlkvre

SCOP Domain Coordinates for d1uspa_:

Click to download the PDB-style file with coordinates for d1uspa_.
(The format of our PDB-style files is described here.)

Timeline for d1uspa_: