Lineage for d1usoa_ (1uso A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200525Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2200526Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2200527Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2200532Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. 2200562Species Thermus thermophilus [TaxId:274] [103072] (2 PDB entries)
  8. 2200564Domain d1usoa_: 1uso A: [99877]
    complexed with so4; mutant

Details for d1usoa_

PDB Entry: 1uso (more details), 1.3 Å

PDB Description: dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant
PDB Compounds: (A:) hepatocyte nuclear factor 1-alpha

SCOPe Domain Sequences for d1usoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usoa_ d.74.1.1 (A:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Thermus thermophilus [TaxId: 274]}
dweerenpkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsag
gvtekdremarltdallq

SCOPe Domain Coordinates for d1usoa_:

Click to download the PDB-style file with coordinates for d1usoa_.
(The format of our PDB-style files is described here.)

Timeline for d1usoa_: