Lineage for d1usma_ (1usm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958013Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2958014Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2958019Protein Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) [55250] (2 species)
  7. 2958049Species Thermus thermophilus [TaxId:274] [103072] (2 PDB entries)
  8. 2958050Domain d1usma_: 1usm A: [99876]
    mutant

Details for d1usma_

PDB Entry: 1usm (more details), 1.2 Å

PDB Description: dcoh, a bifunctional protein-binding transcriptional coactivator, pro9leu mutant
PDB Compounds: (A:) hepatocyte nuclear factor 1-alpha

SCOPe Domain Sequences for d1usma_:

Sequence, based on SEQRES records: (download)

>d1usma_ d.74.1.1 (A:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Thermus thermophilus [TaxId: 274]}
mdweerenlkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsa
ggvtekdremarltdallqr

Sequence, based on observed residues (ATOM records): (download)

>d1usma_ d.74.1.1 (A:) Pterin-4a-carbinolamine dehydratase (PCD)/dimerization cofactor of HNF1 (DCoH) {Thermus thermophilus [TaxId: 274]}
mdweerkrlvktfafpnfrealdfanrvgalaerenhhprltvewgrvtvewwthsaggv
tekdremarltdallqr

SCOPe Domain Coordinates for d1usma_:

Click to download the PDB-style file with coordinates for d1usma_.
(The format of our PDB-style files is described here.)

Timeline for d1usma_: