Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily) 3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold |
Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (1 family) |
Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (2 proteins) |
Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [102273] (1 PDB entry) Rv2465c |
Domain d1usld_: 1usl D: [99874] |
PDB Entry: 1usl (more details), 1.88 Å
SCOP Domain Sequences for d1usld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usld_ c.121.1.1 (D:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis} sgmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadp gslgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeal aivdafvttpwskaqrhqrridilaeyertheappvpg
Timeline for d1usld_:
View in 3D Domains from other chains: (mouse over for more information) d1usla_, d1uslb_, d1uslc_, d1usle_ |