Lineage for d1uslc_ (1usl C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. Family c.121.1.1: Ribose/Galactose isomerase RpiB/AlsB [89624] (3 proteins)
    automatically mapped to Pfam PF02502
  6. Protein Alternate ribose 5-phosphate isomerase B, RpiB [89625] (2 species)
  7. Species Mycobacterium tuberculosis [TaxId:1773] [102273] (6 PDB entries)
    Uniprot Q79FD7
    Rv2465c
  8. Domain d1uslc_: 1usl C: [99873]
    complexed with po4

Details for d1uslc_

PDB Entry: 1usl (more details), 1.8800000000000001 Å

PDB Description: structure of mycobacterium tuberculosis ribose-5-phosphate isomerase, rpib, rv2465c, complexed with phosphate.
PDB Compounds: (C:) Ribose 5-phosphate isomerase B

SCOPe Domain Sequences for d1uslc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uslc_ c.121.1.1 (C:) Alternate ribose 5-phosphate isomerase B, RpiB {Mycobacterium tuberculosis [TaxId: 1773]}
gmrvylgadhagyelkqriiehlkqtghepidcgalrydadddypafciaaatrtvadpg
slgivlggsgngeqiaankvpgarcalawsvqtaalarehnnaqligiggrmhtvaeala
ivdafvttpwskaqrhqrridilaeyertheappvpgap

SCOPe Domain Coordinates for d1uslc_ are not available.

Timeline for d1uslc_:

Domains from other chains:
(mouse over for more information)
d1usla_, d1uslb_, d1usld_, d1usle_