Lineage for d1uskc_ (1usk C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2912919Family c.93.1.1: L-arabinose binding protein-like [53823] (18 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913091Protein Leucine-binding protein [53843] (1 species)
  7. 2913092Species Escherichia coli [TaxId:562] [53844] (4 PDB entries)
  8. 2913098Domain d1uskc_: 1usk C: [99869]
    complexed with leu

Details for d1uskc_

PDB Entry: 1usk (more details), 2 Å

PDB Description: l-leucine-binding protein with leucine bound
PDB Compounds: (C:) leucine-specific binding protein

SCOPe Domain Sequences for d1uskc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uskc_ c.93.1.1 (C:) Leucine-binding protein {Escherichia coli [TaxId: 562]}
ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

SCOPe Domain Coordinates for d1uskc_:

Click to download the PDB-style file with coordinates for d1uskc_.
(The format of our PDB-style files is described here.)

Timeline for d1uskc_: