Lineage for d1usga_ (1usg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143873Protein Leucine-binding protein [53843] (1 species)
  7. 2143874Species Escherichia coli [TaxId:562] [53844] (4 PDB entries)
  8. 2143875Domain d1usga_: 1usg A: [99864]

Details for d1usga_

PDB Entry: 1usg (more details), 1.53 Å

PDB Description: l-leucine-binding protein, apo form
PDB Compounds: (A:) leucine-specific binding protein

SCOPe Domain Sequences for d1usga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]}
ddikvavvgamsgpiaqwgdmefngarqaikdinakggikgdklvgveyddacdpkqava
vankivndgikyvighlcssstqpasdiyedegilmispgatnpeltqrgyqhimrtagl
dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak

SCOPe Domain Coordinates for d1usga_:

Click to download the PDB-style file with coordinates for d1usga_.
(The format of our PDB-style files is described here.)

Timeline for d1usga_: