Lineage for d1usfb_ (1usf B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063872Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. 2063904Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. 2063905Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)
  8. 2063909Domain d1usfb_: 1usf B: [99863]
    complexed with fmn, gol, nap

Details for d1usfb_

PDB Entry: 1usf (more details), 1.3 Å

PDB Description: putative styrene monooxygenase small component with bound nadp+
PDB Compounds: (B:) putative styrene monooxygenase small component

SCOPe Domain Sequences for d1usfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usfb_ b.45.1.2 (B:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d1usfb_:

Click to download the PDB-style file with coordinates for d1usfb_.
(The format of our PDB-style files is described here.)

Timeline for d1usfb_: