Lineage for d1usfa_ (1usf A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. Family b.45.1.2: NADH:FMN oxidoreductase-like [50482] (5 proteins)
    different dimerization mode than in the PNP-oxidase like family
  6. Protein Putative styrene monooxygenase small component [101796] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [101797] (5 PDB entries)
  8. Domain d1usfa_: 1usf A: [99862]
    complexed with fmn, gol, nap

Details for d1usfa_

PDB Entry: 1usf (more details), 1.3 Å

PDB Description: putative styrene monooxygenase small component with bound nadp+
PDB Compounds: (A:) putative styrene monooxygenase small component

SCOPe Domain Sequences for d1usfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usfa_ b.45.1.2 (A:) Putative styrene monooxygenase small component {Thermus thermophilus [TaxId: 274]}
mrsyraqgplpgfyhyypgvpavvgvrveervnfcpavwntglsadpplfgvsispkrft
hglllkarrfsasfhpfgqkdlvhwlgshsgrevdkgqaphflghtgvpilegayaayel
ellevhtfgdhdlfvgrvvavweeeglldekgrpkpglallyygkglygrpaeetfap

SCOPe Domain Coordinates for d1usfa_ are not available.

Timeline for d1usfa_:

Domains from other chains:
(mouse over for more information)
d1usfb_