Lineage for d1us8.1 (1us8 A:,B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2112785Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 protein domains)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2113012Protein Rad50 [52691] (1 species)
  7. 2113013Species Pyrococcus furiosus [TaxId:2261] [52692] (4 PDB entries)
  8. 2113017Domain d1us8.1: 1us8 A:,B: [99859]
    N- and C-terminal subdomains only; the middle coiled coil domain is deleted

Details for d1us8.1

PDB Entry: 1us8 (more details), 2.1 Å

PDB Description: the rad50 signature motif: essential to atp binding and biological function
PDB Compounds: (A:) DNA double-strand break repair rad50 ATPase, (B:) DNA double-strand break repair rad50 ATPase

SCOPe Domain Sequences for d1us8.1:

Sequence, based on SEQRES records: (download)

>g1us8.1 c.37.1.12 (A:,B:) Rad50 {Pyrococcus furiosus [TaxId: 2261]}
mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde
ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais
afmeklipyniflnaiyirqgqidailXlareaalskigelaseifaeftegkysevvvr
aeenkvrlfvvwegkerpltflrggerialglafrlamslylageisllildeptpylde
errrklitimerylkkipqvilvshdeelkdaadhvirislengsskvevvs

Sequence, based on observed residues (ATOM records): (download)

>g1us8.1 c.37.1.12 (A:,B:) Rad50 {Pyrococcus furiosus [TaxId: 2261]}
mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplridtyidli
fekdgtkyritrrflsgeihamkrlvgnewkhvtepsskaisafmeklipyniflnaiyi
rqgqidailXlareaalskigelaseifaeftegkysevvvravrlfvvwegkerpltfl
rggerialglafrlamslylageisllildeptpyldeerrrklitimerylkkipqvil
vshdeelkdaadhvirislengsskvevvs

SCOPe Domain Coordinates for d1us8.1:

Click to download the PDB-style file with coordinates for d1us8.1.
(The format of our PDB-style files is described here.)

Timeline for d1us8.1: