Lineage for d1us7b_ (1us7 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014757Fold a.205: Hsp90 co-chaperone CDC37 [101390] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains connected by a long helix
  4. 2014758Superfamily a.205.1: Hsp90 co-chaperone CDC37 [101391] (1 family) (S)
  5. 2014759Family a.205.1.1: Hsp90 co-chaperone CDC37 [101392] (1 protein)
  6. 2014760Protein Hsp90 co-chaperone CDC37 [101393] (1 species)
  7. 2014761Species Human (Homo sapiens) [TaxId:9606] [101394] (1 PDB entry)
  8. 2014762Domain d1us7b_: 1us7 B: [99858]
    Other proteins in same PDB: d1us7a_

Details for d1us7b_

PDB Entry: 1us7 (more details), 2.3 Å

PDB Description: complex of hsp90 and p50
PDB Compounds: (B:) hsp90 co-chaperone cdc37

SCOPe Domain Sequences for d1us7b_:

Sequence, based on SEQRES records: (download)

>d1us7b_ a.205.1.1 (B:) Hsp90 co-chaperone CDC37 {Human (Homo sapiens) [TaxId: 9606]}
hktfvekyekqikhfgmlrrwddsqkylsdnvhlvceetanylviwcidleveekcalme
qvahqtivmqfilelakslkvdpracfrqfftkiktadrqymegfndeleafkervrgra
klriekamkeyeeeerkkrlgpggldpvevyeslpeelqkcfdvkdvqmlqdaiskmdpt
dakyhmqrcidsglwvpnska

Sequence, based on observed residues (ATOM records): (download)

>d1us7b_ a.205.1.1 (B:) Hsp90 co-chaperone CDC37 {Human (Homo sapiens) [TaxId: 9606]}
hktfvekyekqikhfgmlrrwddsqkylsdnvhlvceetanylviwcidleveekcalme
qvahqtivmqfilelakslkvdpracfrqfftkiktadrqymegfndeleafkervrgra
klriekamkeyeeeerkkrlgpggldpvevyeslpeelqkcmlqdaiskmdptdakyhmq
rcidsglwvpnska

SCOPe Domain Coordinates for d1us7b_:

Click to download the PDB-style file with coordinates for d1us7b_.
(The format of our PDB-style files is described here.)

Timeline for d1us7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1us7a_