Lineage for d1us7a_ (1us7 A:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein) Protein HSP90 [55876] (3 species) 
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55877] (7 PDB entries) 
Domain d1us7a_: 1us7 A: [99857]
Other proteins in same PDB: d1us7b_
Details for d1us7a_
PDB Entry: 1us7 (more details), 2.3 Å
PDB Description: complex of hsp90 and p50
SCOP Domain Sequences for d1us7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1us7a_ d.122.1.1 (A:) HSP90 {Baker's yeast (Saccharomyces cerevisiae)}
asetfefqaeitqlmsliintvysnkeiflrelisnasdaldkirykslsdpkqletepd
lfiritpkpeqkvleirdsgigmtkaelinnlgtiaksgtkafmealsagadvsmigqfg
vgfyslflvadrvqvisksnddeqyiwesnaggsftvtldevnerigrgtilrlflkddq
leyleekrikevikrhsefvaypiqlv
SCOP Domain Coordinates for d1us7a_:
Click to download the PDB-style file with coordinates for d1us7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1us7a_:
- d1us7a_ first appeared in SCOP 1.67
- d1us7a_ appears in SCOP 1.71
- d1us7a_ appears in the current release, SCOPe 2.08
View in 3D
