Lineage for d1us3a2 (1us3 A:243-606)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571449Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 571746Protein Xylanase 10c [102071] (1 species)
    Endo-beta-1,4-xylanase
  7. 571747Species Cellvibrio japonicus [TaxId:498211] [102072] (2 PDB entries)
  8. 571748Domain d1us3a2: 1us3 A:243-606 [99854]
    Other proteins in same PDB: d1us3a1
    complexed with gol, na, trs

Details for d1us3a2

PDB Entry: 1us3 (more details), 1.85 Å

PDB Description: native xylanase10c from cellvibrio japonicus

SCOP Domain Sequences for d1us3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus}
aysanvdhlrdlapsdfpigvavsntdsatynlltnsreqavvkkhfnhltagnimkmsy
mqptegnfnftnadafvdwatennmtvhghalvwhsdyqvpnfmknwagsaedflaaldt
hittivdhyeakgnlvswdvvneaiddnspanfrttdsafyvksgnssvyierafqtara
adpavilyyndynieqnnakttkmvdmvkdfqarsipidgvgfqmhvcmnypsianisaa
mkkvvdlgllvkiteldvavnqphcdaypankinplteaaqlaqkkrycdvvkayldtvp
vnqrggisvwgttdantwldglyreqfedekiswpllfdnnyndkpalrgfadaligtqc
tnth

SCOP Domain Coordinates for d1us3a2:

Click to download the PDB-style file with coordinates for d1us3a2.
(The format of our PDB-style files is described here.)

Timeline for d1us3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1us3a1