Lineage for d1us3a1 (1us3 A:98-238)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458865Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 458866Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families) (S)
  5. 459103Family b.18.1.11: CBM15 [69216] (1 protein)
  6. 459104Protein Xylan-binding module from xylanase 10c [69217] (1 species)
  7. 459105Species Cellvibrio japonicus [TaxId:498211] [69218] (3 PDB entries)
    synonym: Pseudomonas cellulosa
  8. 459107Domain d1us3a1: 1us3 A:98-238 [99853]
    Other proteins in same PDB: d1us3a2

Details for d1us3a1

PDB Entry: 1us3 (more details), 1.85 Å

PDB Description: native xylanase10c from cellvibrio japonicus

SCOP Domain Sequences for d1us3a1:

Sequence, based on SEQRES records: (download)

>d1us3a1 b.18.1.11 (A:98-238) Xylan-binding module from xylanase 10c {Cellvibrio japonicus}
dmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledaviamvvnvsa
efkaseanlqifaqlkedwskgewdclaasseltadtdltltctidedddkfnqtardvq
vgiqakgtpagtitiksvtit

Sequence, based on observed residues (ATOM records): (download)

>d1us3a1 b.18.1.11 (A:98-238) Xylan-binding module from xylanase 10c {Cellvibrio japonicus}
dmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiamvvnvsaefkaseanlqi
faqlkedwskewdclaasseltdltltctkfnqtdvqvgiqakgtpagtitiksvtit

SCOP Domain Coordinates for d1us3a1:

Click to download the PDB-style file with coordinates for d1us3a1.
(The format of our PDB-style files is described here.)

Timeline for d1us3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1us3a2