Lineage for d1us2a2 (1us2 A:243-606)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082160Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2082686Protein Xylanase 10c [102071] (1 species)
    Endo-beta-1,4-xylanase
  7. 2082687Species Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId:155077] [102072] (2 PDB entries)
  8. 2082689Domain d1us2a2: 1us2 A:243-606 [99852]
    Other proteins in same PDB: d1us2a1
    mutant

Details for d1us2a2

PDB Entry: 1us2 (more details), 1.85 Å

PDB Description: xylanase10c (mutant e385a) from cellvibrio japonicus in complex with xylopentaose
PDB Compounds: (A:) endo-beta-1,4-xylanase

SCOPe Domain Sequences for d1us2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1us2a2 c.1.8.3 (A:243-606) Xylanase 10c {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]}
aysanvdhlrdlapsdfpigvavsntdsatynlltnsreqavvkkhfnhltagnimkmsy
mqptegnfnftnadafvdwatennmtvhghalvwhsdyqvpnfmknwagsaedflaaldt
hittivdhyeakgnlvswdvvnaaiddnspanfrttdsafyvksgnssvyierafqtara
adpavilyyndynieqnnakttkmvdmvkdfqarsipidgvgfqmhvcmnypsianisaa
mkkvvdlgllvkiteldvavnqphcdaypankinplteaaqlaqkkrycdvvkayldtvp
vnqrggisvwgttdantwldglyreqfedekiswpllfdnnyndkpalrgfadaligtqc
tnth

SCOPe Domain Coordinates for d1us2a2:

Click to download the PDB-style file with coordinates for d1us2a2.
(The format of our PDB-style files is described here.)

Timeline for d1us2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1us2a1