Lineage for d1urzf1 (1urz F:303-401)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658925Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 658926Protein Envelope glycoprotein [49213] (5 species)
  7. 658948Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)
  8. 658955Domain d1urzf1: 1urz F:303-401 [99848]
    Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2

Details for d1urzf1

PDB Entry: 1urz (more details), 2.7 Å

PDB Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
PDB Compounds: (F:) envelope protein

SCOP Domain Sequences for d1urzf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urzf1 b.1.18.4 (F:303-401) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqkgssigr

SCOP Domain Coordinates for d1urzf1:

Click to download the PDB-style file with coordinates for d1urzf1.
(The format of our PDB-style files is described here.)

Timeline for d1urzf1: