Lineage for d1urze1 (1urz E:303-401)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1299774Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 1299775Protein Envelope glycoprotein [49213] (5 species)
  7. 1299800Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries)
  8. 1299806Domain d1urze1: 1urz E:303-401 [99846]
    Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2

Details for d1urze1

PDB Entry: 1urz (more details), 2.7 Å

PDB Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
PDB Compounds: (E:) envelope protein

SCOPe Domain Sequences for d1urze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urze1 b.1.18.4 (E:303-401) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp
tienngggfiemqlppgdniiyvgelshqwfqkgssigr

SCOPe Domain Coordinates for d1urze1:

Click to download the PDB-style file with coordinates for d1urze1.
(The format of our PDB-style files is described here.)

Timeline for d1urze1: