![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
![]() | Protein Envelope glycoprotein [49213] (5 species) |
![]() | Species Tick-borne encephalitis virus [TaxId:11084] [49214] (2 PDB entries) |
![]() | Domain d1urzc1: 1urz C:303-401 [99842] Other proteins in same PDB: d1urza2, d1urzb2, d1urzc2, d1urzd2, d1urze2, d1urzf2 |
PDB Entry: 1urz (more details), 2.7 Å
SCOPe Domain Sequences for d1urzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1urzc1 b.1.18.4 (C:303-401) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]} tytmcdktkftwkraptdsghdtvvmevtfsgtkpcripvravahgspdvnvamlitpnp tienngggfiemqlppgdniiyvgelshqwfqkgssigr
Timeline for d1urzc1: