Lineage for d1urzb2 (1urz B:2-302)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2225037Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2225038Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2225039Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 protein domains)
  6. 2225040Protein Envelope glycoprotein [56985] (2 species)
  7. 2225059Species Tick-borne encephalitis virus [TaxId:11084] [56986] (2 PDB entries)
  8. 2225062Domain d1urzb2: 1urz B:2-302 [99841]
    Other proteins in same PDB: d1urza1, d1urzb1, d1urzc1, d1urzd1, d1urze1, d1urzf1

Details for d1urzb2

PDB Entry: 1urz (more details), 2.7 Å

PDB Description: low ph induced, membrane fusion conformation of the envelope protein of tick-borne encephalitis virus
PDB Compounds: (B:) envelope protein

SCOPe Domain Sequences for d1urzb2:

Sequence, based on SEQRES records: (download)

>d1urzb2 f.10.1.1 (B:2-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
eakkkatghvydankivytvkvephtgdyvaanethsgrktasftissektiltmgeygd
vsllcrvasgvdlaqtvileldktvehlptawqvhrdwfndlalpwkhegaqnwnnaerl
vefgaphavkmdvynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkg
l

Sequence, based on observed residues (ATOM records): (download)

>d1urzb2 f.10.1.1 (B:2-302) Envelope glycoprotein {Tick-borne encephalitis virus [TaxId: 11084]}
rcthlenrdfvtgtqgttrvtlvlelggcvtitaegkpsmdvwldaiyqenpaktreycl
haklsdtkvaarcptmgpatlaeehqggtvckrdqsdrgwgnhcglfgkgsivacvkaac
eakkkatghvydankivytvkvephtrktasftissektiltmgeygdvsllcrvasgvd
laqtvileldktvehptawqvhrdwfndlalpwkhegaqnwnnaerlvefgaphavkmdv
ynlgdqtgvllkalagvpvahiegtkyhlksghvtcevgleklkmkgl

SCOPe Domain Coordinates for d1urzb2:

Click to download the PDB-style file with coordinates for d1urzb2.
(The format of our PDB-style files is described here.)

Timeline for d1urzb2: