Lineage for d1ursb_ (1urs B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403440Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 403441Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 403442Family c.94.1.1: Phosphate binding protein-like [53851] (26 proteins)
  6. 403463Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 403464Species Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries)
  8. 403466Domain d1ursb_: 1urs B: [99834]
    complexed with mlr

Details for d1ursb_

PDB Entry: 1urs (more details), 1.45 Å

PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius

SCOP Domain Sequences for d1ursb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ursb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius}
titvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvvf
gmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynkk
lvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldtp
gavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgvt
pwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipalls
vqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdfv
qniqkg

SCOP Domain Coordinates for d1ursb_:

Click to download the PDB-style file with coordinates for d1ursb_.
(The format of our PDB-style files is described here.)

Timeline for d1ursb_: