SCOPe 2.08: Domain d1ursb_: 1urs B:

Lineage for d1ursb_ (1urs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries)

8. Domain d1ursb_: 1urs B: [99834]
   has additional insertions and/or extensions that are not grouped together

Details for d1ursb_

PDB Entry: 1urs, 1.45 Å

PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius

PDB Compounds: (B:) maltose-binding protein

SCOPe Domain Sequences for d1ursb_:

Sequence; same for both SEQRES and ATOM records:

>d1ursb_ c.94.1.1 (B:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]}
titvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvvf
gmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynkk
lvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldtp
gavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgvt
pwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipalls
vqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdfv
qniqkg

Timeline for d1ursb_:

• d1ursb_ first appeared in SCOP 1.67
  
• d1ursb_ appears in SCOPe 2.07