SCOPe 2.05: Domain d1ursa_: 1urs A:

Lineage for d1ursa_ (1urs A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries)

8. Domain d1ursa_: 1urs A: [99833]
   complexed with mlr

Details for d1ursa_

PDB Entry: 1urs, 1.45 Å

PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius

PDB Compounds: (A:) maltose-binding protein

SCOPe Domain Sequences for d1ursa_:

Sequence; same for both SEQRES and ATOM records:

>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]}
qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
vqniqkg

Timeline for d1ursa_:

• d1ursa_ first appeared in SCOP 1.67
  
• d1ursa_ appears in SCOPe 2.04
  
• d1ursa_ appears in SCOPe 2.06
  
• d1ursa_ appears in the current release, SCOPe 2.08