SCOPe 2.03: Domain d1urha1: 1urh A:2-148

Lineage for d1urha1 (1urh A:2-148)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein 3-mercaptopyruvate sulfurtransferase [102427] (2 species)

7. Species Escherichia coli [TaxId:562] [102429] (1 PDB entry)

8. Domain d1urha1: 1urh A:2-148 [99829]
   complexed with so3

Details for d1urha1

PDB Entry: 1urh, 2.8 Å

PDB Description: the "rhodanese" fold and catalytic mechanism of 3-mercaptopyruvate sulfotransferases: crystal structure of ssea from escherichia coli

PDB Compounds: (A:) 3-mercaptopyruvate sulfurtransferase

SCOPe Domain Sequences for d1urha1:

Sequence; same for both SEQRES and ATOM records:

>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]}
ttwfvgadwlaehiddpeiqiidarmaspgqedrnvaqeylnghipgavffdiealsdht
splphmlprpetfavamrelgvnqdkhlivydegnlfsaprawwmlrtfgvekvsilggg
lagwqrddllleegavelpegefnaaf

Timeline for d1urha1:

• d1urha1 first appeared in SCOP 1.67
  
• d1urha1 appears in SCOPe 2.02
  
• d1urha1 appears in SCOPe 2.04
  
• d1urha1 appears in the current release, SCOPe 2.08