SCOP 1.71: Domain d1urda_: 1urd A:

Lineage for d1urda_ (1urd A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries)

8. Domain d1urda_: 1urd A: [99825]

Details for d1urda_

PDB Entry: 1urd, 1.53 Å

PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius provide insight into acid stability of proteins

SCOP Domain Sequences for d1urda_:

Sequence; same for both SEQRES and ATOM records:

>d1urda_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius}
qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
vqniqkgima

Timeline for d1urda_:

• d1urda_ first appeared in SCOP 1.67
  
• d1urda_ appears in SCOP 1.69
  
• d1urda_ appears in SCOP 1.73
  
• d1urda_ appears in the current release, SCOPe 2.08