Lineage for d1urda_ (1urd A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 494730Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 494731Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 494732Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins)
  6. 494753Protein D-maltodextrin-binding protein, MBP [53862] (4 species)
    contains a few additional helices in the C-terminal extension; homologous to thiaminase I
  7. 494754Species Alicyclobacillus acidocaldarius [TaxId:405212] [102690] (3 PDB entries)
  8. 494757Domain d1urda_: 1urd A: [99825]

Details for d1urda_

PDB Entry: 1urd (more details), 1.53 Å

PDB Description: x-ray structures of the maltose-maltodextrin binding protein of the thermoacidophilic bacterium alicyclobacillus acidocaldarius provide insight into acid stability of proteins

SCOP Domain Sequences for d1urda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1urda_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius}
qtitvwswqtgpelqdvkqiaaqwakahgdkvivvdqssnpkgfqfyataartgkgpdvv
fgmphdnngvfaeeglmapvpsgvlntglyapntidaikvngtmysvpvsvqvaaiyynk
klvpqppqtwaefvkdanahgfmydqanlyfdyaiiggyggyvfkdnngtldpnnigldt
pgavqaytlmrdmvskyhwmtpstngsiakaeflagkigmyvsgpwdtadiekakidfgv
tpwptlpngkhatpflgvitafvnkesktqaadwslvqaltsaqaqqmyfrdsqqipall
svqrssavqssptfkafveqlryavpmpnipqmqavwqamsilqniiagkvspeqgakdf
vqniqkgima

SCOP Domain Coordinates for d1urda_:

Click to download the PDB-style file with coordinates for d1urda_.
(The format of our PDB-style files is described here.)

Timeline for d1urda_: