Lineage for d1ur9b3 (1ur9 B:292-379)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720612Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 720613Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 720662Protein Chitinase B [54560] (1 species)
  7. 720663Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 720677Domain d1ur9b3: 1ur9 B:292-379 [99824]
    Other proteins in same PDB: d1ur9a1, d1ur9a2, d1ur9b1, d1ur9b2
    complexed with gdl, gol, nag, phj, so4; mutant

Details for d1ur9b3

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone
PDB Compounds: (B:) chitinase b

SCOP Domain Sequences for d1ur9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9b3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1ur9b3:

Click to download the PDB-style file with coordinates for d1ur9b3.
(The format of our PDB-style files is described here.)

Timeline for d1ur9b3: