Lineage for d1ur9b3 (1ur9 B:292-379)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. Protein Chitinase B [54560] (1 species)
  7. Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)
  8. Domain d1ur9b3: 1ur9 B:292-379 [99824]
    Other proteins in same PDB: d1ur9a1, d1ur9a2, d1ur9b1, d1ur9b2
    complexed with gol, phj, so4

Details for d1ur9b3

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1ur9b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9b3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOPe Domain Coordinates for d1ur9b3 are not available.

Timeline for d1ur9b3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur9b1, d1ur9b2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ur9a1, d1ur9a2, d1ur9a3