Lineage for d1ur9b2 (1ur9 B:2-291,B:380-446)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2440387Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2440446Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 2440447Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 2440473Domain d1ur9b2: 1ur9 B:2-291,B:380-446 [99823]
    Other proteins in same PDB: d1ur9a1, d1ur9a3, d1ur9b1, d1ur9b3
    complexed with gdl, gol, nag, phj, so4

Details for d1ur9b2

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1ur9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9b2 c.1.8.5 (B:2-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
strkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnleca
wdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasra
kfaqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyql
tiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyn
alreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyk
akyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1ur9b2:

Click to download the PDB-style file with coordinates for d1ur9b2.
(The format of our PDB-style files is described here.)

Timeline for d1ur9b2: