SCOPe 2.07: Domain d1ur9b1: 1ur9 B:447-499

Lineage for d1ur9b1 (1ur9 B:447-499)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)

8. Domain d1ur9b1: 1ur9 B:447-499 [99822]
   Other proteins in same PDB: d1ur9a2, d1ur9a3, d1ur9b2, d1ur9b3
   complexed with gdl, gol, nag, phj, so4

Details for d1ur9b1

PDB Entry: 1ur9, 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1ur9b1:

Sequence; same for both SEQRES and ATOM records:

>d1ur9b1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrvr

Timeline for d1ur9b1:

• d1ur9b1 first appeared in SCOP 1.67
  
• d1ur9b1 appears in SCOPe 2.06
  
• d1ur9b1 appears in the current release, SCOPe 2.08