Lineage for d1ur9a3 (1ur9 A:292-379)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410016Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 410161Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 410162Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 410189Protein Chitinase B [54560] (1 species)
  7. 410190Species Serratia marcescens [TaxId:615] [54561] (14 PDB entries)
  8. 410203Domain d1ur9a3: 1ur9 A:292-379 [99821]
    Other proteins in same PDB: d1ur9a1, d1ur9a2, d1ur9b1, d1ur9b2

Details for d1ur9a3

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

SCOP Domain Sequences for d1ur9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9a3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1ur9a3:

Click to download the PDB-style file with coordinates for d1ur9a3.
(The format of our PDB-style files is described here.)

Timeline for d1ur9a3: