Lineage for d1ur9a2 (1ur9 A:3-291,A:380-446)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 385175Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 385202Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 385203Species Serratia marcescens [TaxId:615] [51547] (14 PDB entries)
  8. 385216Domain d1ur9a2: 1ur9 A:3-291,A:380-446 [99820]
    Other proteins in same PDB: d1ur9a1, d1ur9a3, d1ur9b1, d1ur9b3

Details for d1ur9a2

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

SCOP Domain Sequences for d1ur9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9a2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdinweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1ur9a2:

Click to download the PDB-style file with coordinates for d1ur9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ur9a2: