Lineage for d1ur9a1 (1ur9 A:447-499)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) (S)
  5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)
  6. Protein Chitinase B, C-terminal domain [51061] (1 species)
  7. Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)
  8. Domain d1ur9a1: 1ur9 A:447-499 [99819]
    Other proteins in same PDB: d1ur9a2, d1ur9a3, d1ur9b2, d1ur9b3
    complexed with gol, phj, so4

Details for d1ur9a1

PDB Entry: 1ur9 (more details), 1.8 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone
PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1ur9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur9a1 b.72.2.1 (A:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrvr

SCOPe Domain Coordinates for d1ur9a1 are not available.

Timeline for d1ur9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur9a2, d1ur9a3
View in 3D
Domains from other chains:
(mouse over for more information)
d1ur9b1, d1ur9b2, d1ur9b3