Lineage for d1ur8b2 (1ur8 B:3-291,B:380-446)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474902Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 474929Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 474930Species Serratia marcescens [TaxId:615] [51547] (14 PDB entries)
  8. 474950Domain d1ur8b2: 1ur8 B:3-291,B:380-446 [99817]
    Other proteins in same PDB: d1ur8a1, d1ur8a3, d1ur8b1, d1ur8b3

Details for d1ur8b2

PDB Entry: 1ur8 (more details), 1.9 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

SCOP Domain Sequences for d1ur8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur8b2 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOP Domain Coordinates for d1ur8b2:

Click to download the PDB-style file with coordinates for d1ur8b2.
(The format of our PDB-style files is described here.)

Timeline for d1ur8b2: