| Class b: All beta proteins [48724] (141 folds) |
| Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) ![]() |
| Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
| Protein Chitinase B, C-terminal domain [51061] (1 species) |
| Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries) |
| Domain d1ur8b1: 1ur8 B:447-499 [99816] Other proteins in same PDB: d1ur8a2, d1ur8a3, d1ur8b2, d1ur8b3 complexed with gdl, gol, nag, so4 |
PDB Entry: 1ur8 (more details), 1.9 Å
SCOP Domain Sequences for d1ur8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ur8b1 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1ur8b1: