SCOP 1.67: Domain d1ur8a1: 1ur8 A:447-499

Lineage for d1ur8a1 (1ur8 A:447-499)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (14 PDB entries)

8. Domain d1ur8a1: 1ur8 A:447-499 [99813]
   Other proteins in same PDB: d1ur8a2, d1ur8a3, d1ur8b2, d1ur8b3

Details for d1ur8a1

PDB Entry: 1ur8, 1.9 Å

PDB Description: interactions of a family 18 chitinase with the designed inhibitor hm508, and its degradation product, chitobiono-delta-lactone

SCOP Domain Sequences for d1ur8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ur8a1 b.72.2.1 (A:447-499) Chitinase B, C-terminal domain {Serratia marcescens}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1ur8a1:

• d1ur8a1 is new in SCOP 1.67
  
• d1ur8a1 appears in SCOP 1.69
  
• d1ur8a1 appears in the current release, SCOPe 2.08