Lineage for d1ur6b_ (1ur6 B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264067Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 2264068Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 2264069Family g.44.1.1: RING finger domain, C3HC4 [57851] (15 proteins)
  6. 2264098Protein Not-4 N-terminal RING finger domain [64579] (1 species)
  7. 2264099Species Human (Homo sapiens) [TaxId:9606] [64580] (2 PDB entries)
  8. 2264101Domain d1ur6b_: 1ur6 B: [99812]
    Other proteins in same PDB: d1ur6a_
    complexed with zn

Details for d1ur6b_

PDB Entry: 1ur6 (more details)

PDB Description: nmr based structural model of the ubch5b-cnot4 complex
PDB Compounds: (B:) potential transcriptional repressor not4hp

SCOPe Domain Sequences for d1ur6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}
vecplcmepleiddinffpctcgyqicrfcwhrirtdenglcpacrkpyped

SCOPe Domain Coordinates for d1ur6b_:

Click to download the PDB-style file with coordinates for d1ur6b_.
(The format of our PDB-style files is described here.)

Timeline for d1ur6b_: