SCOP 1.67: Domain d1ur6a_: 1ur6 A:

Lineage for d1ur6a_ (1ur6 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (2 families)

5. Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (17 species)

7. Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (1 PDB entry)
   E2-17 kDa 2

8. Domain d1ur6a_: 1ur6 A: [99811]
   Other proteins in same PDB: d1ur6b_
   complexed with zn

Details for d1ur6a_

PDB Entry: 1ur6

PDB Description: nmr based structural model of the ubch5b-cnot4 complex

SCOP Domain Sequences for d1ur6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ur6a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b}
malkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d1ur6a_:

• d1ur6a_ is new in SCOP 1.67
  
• d1ur6a_ appears in SCOP 1.69
  
• d1ur6a_ appears in the current release, SCOPe 2.08