Lineage for d1ur5c2 (1ur5 C:144-309)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1441114Protein Malate dehydrogenase [56329] (12 species)
  7. 1441131Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries)
    Uniprot P80040
  8. 1441135Domain d1ur5c2: 1ur5 C:144-309 [99810]
    Other proteins in same PDB: d1ur5a1, d1ur5c1
    complexed with cd, cl, na, nad

Details for d1ur5c2

PDB Entry: 1ur5 (more details), 1.75 Å

PDB Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1ur5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur5c2 d.162.1.1 (C:144-309) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfscisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

SCOPe Domain Coordinates for d1ur5c2:

Click to download the PDB-style file with coordinates for d1ur5c2.
(The format of our PDB-style files is described here.)

Timeline for d1ur5c2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur5c1