SCOP 1.75: Domain d1ur5c2: 1ur5 C:144-309

Lineage for d1ur5c2 (1ur5 C:144-309)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)

6. Protein Malate dehydrogenase [56329] (11 species)

7. Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries)
   Uniprot P80040

8. Domain d1ur5c2: 1ur5 C:144-309 [99810]
   Other proteins in same PDB: d1ur5a1, d1ur5c1
   complexed with cd, cl, na, nad; mutant

Details for d1ur5c2

PDB Entry: 1ur5, 1.75 Å

PDB Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface

PDB Compounds: (C:) malate dehydrogenase

SCOP Domain Sequences for d1ur5c2:

Sequence; same for both SEQRES and ATOM records:

>d1ur5c2 d.162.1.1 (C:144-309) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfscisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtlksl

Timeline for d1ur5c2:

• d1ur5c2 first appeared in SCOP 1.67
  
• d1ur5c2 appears in SCOP 1.73
  
• d1ur5c2 appears in SCOPe 2.01
  
• d1ur5c2 appears in the current release, SCOPe 2.08