Lineage for d1ur5a1 (1ur5 A:2-143)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2452663Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2453110Protein Malate dehydrogenase [51849] (13 species)
  7. 2453132Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries)
    Uniprot P80040
  8. 2453133Domain d1ur5a1: 1ur5 A:2-143 [99807]
    Other proteins in same PDB: d1ur5a2, d1ur5c2
    complexed with cd, cl, na, nad

Details for d1ur5a1

PDB Entry: 1ur5 (more details), 1.75 Å

PDB Description: stabilization of a tetrameric malate dehydrogenase by introduction of a disulfide bridge at the dimer/dimer interface
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1ur5a1:

Sequence, based on SEQRES records: (download)

>d1ur5a1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq

Sequence, based on observed residues (ATOM records): (download)

>d1ur5a1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaedlikvnaditracisqaaplspnaviimvnnpldamtyla
aevsgfpkervigq

SCOPe Domain Coordinates for d1ur5a1:

Click to download the PDB-style file with coordinates for d1ur5a1.
(The format of our PDB-style files is described here.)

Timeline for d1ur5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur5a2