Lineage for d1ur2a1 (1ur2 A:25-370)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831084Protein Xylanase [51488] (6 species)
  7. 2831109Species Cellvibrio mixtus [TaxId:39650] [102064] (4 PDB entries)
  8. 2831112Domain d1ur2a1: 1ur2 A:25-370 [99805]
    Other proteins in same PDB: d1ur2a2
    complexed with cl, mg; mutant

Details for d1ur2a1

PDB Entry: 1ur2 (more details), 1.6 Å

PDB Description: xylanase xyn10b mutant (e262s) from cellvibrio mixtus in complex with arabinofuranose alpha 1,3 linked to xylotriose
PDB Compounds: (A:) endoxylanase

SCOPe Domain Sequences for d1ur2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ur2a1 c.1.8.3 (A:25-370) Xylanase {Cellvibrio mixtus [TaxId: 39650]}
tglksaykdnfligaalnatiasgaderlntliakefnsitpencmkwgvlrdaqgqwnw
kdadafvafgtkhnlhmvghtlvwhsqihdevfknadgsyiskaalqkkmeehittlagr
ykgklaawdvvneavgddlkmrdshwykimgddfiynaftlanevdpkahlmyndynier
tgkreatvemierlqkrgmpihglgiqghlgidtppiaeieksiiafaklglrvhftsld
vdvlpsvwelpvaevstrfeykperdpytkglpqemqdklakryedlfklfikhsdkidr
atfwgvsddaswlngfpipgrtnypllfdrklqpkdayfrlldlkr

SCOPe Domain Coordinates for d1ur2a1:

Click to download the PDB-style file with coordinates for d1ur2a1.
(The format of our PDB-style files is described here.)

Timeline for d1ur2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ur2a2