SCOP 1.71: Domain d1uqwb_: 1uqw B:

Lineage for d1uqwb_ (1uqw B:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein Hypothetical protein YliB [102692] (1 species)
   similar domain organization to oligo- and dipeptide-binding protein

7. Species Escherichia coli [TaxId:562] [102693] (1 PDB entry)

8. Domain d1uqwb_: 1uqw B: [99800]
   complexed with gol, zn

Details for d1uqwb_

PDB Entry: 1uqw, 2.72 Å

PDB Description: crystal structure of ylib protein from escherichia coi

SCOP Domain Sequences for d1uqwb_:

Sequence; same for both SEQRES and ATOM records:

>d1uqwb_ c.94.1.1 (B:) Hypothetical protein YliB {Escherichia coli}
aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
fedadlq

Timeline for d1uqwb_:

• d1uqwb_ first appeared in SCOP 1.67
  
• d1uqwb_ appears in SCOP 1.69
  
• d1uqwb_ appears in SCOP 1.73
  
• d1uqwb_ appears in the current release, SCOPe 2.08