Lineage for d1uqwb_ (1uqw B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. Protein Hypothetical protein YliB [102692] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. Species Escherichia coli [TaxId:562] [102693] (1 PDB entry)
  8. Domain d1uqwb_: 1uqw B: [99800]
    complexed with gol, zn

Details for d1uqwb_

PDB Entry: 1uqw (more details), 2.72 Å

PDB Description: crystal structure of ylib protein from escherichia coi
PDB Compounds: (B:) putative binding protein ylib

SCOPe Domain Sequences for d1uqwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqwb_ c.94.1.1 (B:) Hypothetical protein YliB {Escherichia coli [TaxId: 562]}
aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
fedadlq

SCOPe Domain Coordinates for d1uqwb_ are not available.

Timeline for d1uqwb_:

Domains from other chains:
(mouse over for more information)
d1uqwa_