Lineage for d1uqwa_ (1uqw A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 710610Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 710611Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 710612Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)
  6. 710965Protein Hypothetical protein YliB [102692] (1 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 710966Species Escherichia coli [TaxId:562] [102693] (1 PDB entry)
  8. 710967Domain d1uqwa_: 1uqw A: [99799]

Details for d1uqwa_

PDB Entry: 1uqw (more details), 2.72 Å

PDB Description: crystal structure of ylib protein from escherichia coi
PDB Compounds: (A:) putative binding protein ylib

SCOP Domain Sequences for d1uqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqwa_ c.94.1.1 (A:) Hypothetical protein YliB {Escherichia coli [TaxId: 562]}
aakdvvvavgsnfttldpydandtlsqavaksfyqglfgldkemklknvlaesytvsddg
itytvklregikfqdgtdfnaaavkanldrasdpanhlkrhnlykniakteaidpttvki
tlkqpfsafinilahpatamispaalekygkeigfypvgtgpyeldtwnqtdfvkvkkfa
gywqpglpkldsitwrpvadnntraamlqtgeaqfafpipyeqatlleknknielmasps
imqryismnvtqkpfdnpkvrealnyainrpalvkvafagyatpatgvvppsiayaqsyk
pwpydpvkarellkeagypngfsttlwsshnhstaqkvlqftqqqlaqvgikaqvtamda
gqraaevegkgqkesgvrmfytgwsastgeadwalsplfasqnwpptlfntafysnkqvd
dflaqalktndpaektrlykaaqdiiwqespwiplvveklvsahsknltgfwimpdtgfs
fedadlq

SCOP Domain Coordinates for d1uqwa_:

Click to download the PDB-style file with coordinates for d1uqwa_.
(The format of our PDB-style files is described here.)

Timeline for d1uqwa_: