Lineage for d1uqva1 (1uqv A:27-108)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324210Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2324255Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 protein domains)
  6. 2324319Protein Ste50p, N-terminal domain [101244] (1 species)
  7. 2324320Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101245] (2 PDB entries)
  8. 2324322Domain d1uqva1: 1uqv A:27-108 [99798]
    Other proteins in same PDB: d1uqva2

Details for d1uqva1

PDB Entry: 1uqv (more details)

PDB Description: sam domain from ste50p
PDB Compounds: (A:) ste50 protein

SCOPe Domain Sequences for d1uqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uqva1 a.60.1.2 (A:27-108) Ste50p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnnedfsqwsvddvitwcistleveetdplcqrlrendivgdllpelclqdcqdlcdgdl
nkaikfkilinkmrdsklewkd

SCOPe Domain Coordinates for d1uqva1:

Click to download the PDB-style file with coordinates for d1uqva1.
(The format of our PDB-style files is described here.)

Timeline for d1uqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uqva2